PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 259aa    MW: 28778.6 Da    PI: 7.5028
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022325genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF511.8e-16643340
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                 ie+ks r+ tf+kR++g++KK  ELS+LC+++++ i+ 
  Lus10022325  6 IEDKSARKATFTKRKKGVMKKVRELSTLCGIQACAIVN 43
                 9*********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002664.14E-22183No hitNo description
PROSITE profilePS5006615.04142IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-14157IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-19294IPR002100Transcription factor, MADS-box
PfamPF003191.1E-16648IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MKLVYIEDKS ARKATFTKRK KGVMKKVREL STLCGIQACA IVNNPFDKTQ PPETWPPTLG  60
EVHQVLNRFK NMPTVNQRKK MVSQEKFLID RIKKTADQTN KYYHDNCQKE VDLAVTHCLT  120
GRMELTGLTL NDYDLISQGI NRKIQGIDQR LAELSRGDDR RNAQVAPQVA NYHGNGGGGD  180
VQGMDGQHLL TEAMMNPTAA SAPAIEDELM TMLMMMQQGS GTGDNRGVGE SSSNVEAMSI  240
SNSNSVWSNS DPFFDWDF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-31M-type_MADS family protein